IL-9 anticorps (Middle Region)

N° du produit ABIN634807

Cet anticorps Lapin Polyclonal détecte spécifiquement IL-9 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour IL-9 anticorps (Middle Region) (ABIN634807)

Antigène: IL-9 (IL9) (Interleukin 9 (IL9))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IL-9 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-IL-9 anticorps

Épitope: Middle Region

Specificité: IL9 antibody was raised against the middle region of IL9

Purification: Affinity purified

Immunogène: IL9 antibody was raised using the middle region of IL9 corresponding to a region with amino acids SQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IL9 Blocking Peptide, (ABIN5614179), is also available for use as a blocking control in assays to test for specificity of this IL9 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IL-9

Antigène: IL-9 (IL9) (Interleukin 9 (IL9))

Autre désignation: IL9

Sujet: IL9 is a cytokine that acts as a regulator of a variety of hematopoietic cells. This cytokine stimulates cell proliferation and prevents apoptosis. It functions through the interleukin 9 receptor (IL9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes. The gene encoding IL9 has been identified as a candidate gene for asthma. Genetic studies on a mouse model of asthma demonstrated that IL9 is a determining factor in the pathogenesis of bronchial hyperresponsiveness.

Poids moléculaire: 14 kDa (MW of target protein)

Pathways: Signalistation JAK/STAT